Utilitiestrainingcentre / Home

Robots.txt Information

Robot	Path	Permission
GoogleBot	/	✔
BingBot	/	✔
BaiduSpider	/	✔
YandexBot	/	✔

Meta Tags

Title	Home
Description	N/A
Keywords	N/A

Server Information

WebSite	www.utilitiestrainingcentre.co.uk
Host IP	213.175.208.189
Location	United Kingdom

Related Websites

                    Site
                    Rank
                

More to Explore

utic.com.tn

vashikaranspecialistankitsharma.wordpress.com

visioninternationalschool.net

Utilitiestrainingcentre.co.uk Valuation

US$8,062

Last updated: Feb 23, 2021

Utilitiestrainingcentre.co.uk has global traffic rank of 4,205,430. Utilitiestrainingcentre.co.uk has an estimated worth of US$ 8,062, based on its estimated Ads revenue. Utilitiestrainingcentre.co.uk receives approximately 736 unique visitors each day. Its web server is located in United Kingdom, with IP address 213.175.208.189. According to SiteAdvisor, utilitiestrainingcentre.co.uk is unknown to visit.

Traffic & Worth Estimates

Purchase/Sale Value	US$8,062
Daily Ads Revenue	US$4
Monthly Ads Revenue	US$132
Yearly Ads Revenue	US$1,612
Daily Unique Visitors	736
Note: All traffic and earnings values are estimates.

Traffic Ranks

Global Rank	4,205,430
Delta (90 Days)	0
Most Popular In Country	N/A
Country Rank	N/A

DNS Records

Host	Type	TTL	Data
utilitiestrainingcentre.co.uk	A	299	IP: 213.175.208.189
utilitiestrainingcentre.co.uk	MX	299	Priority: 1 Target: mail.vtshosting21.co.uk.
utilitiestrainingcentre.co.uk	NS	21599	Target: tom.ns.cloudflare.com.
utilitiestrainingcentre.co.uk	NS	21599	Target: roxy.ns.cloudflare.com.
utilitiestrainingcentre.co.uk	TXT	299	TXT: v=spf1 a mx ptr
utilitiestrainingcentre.co.uk	SOA	3599	MNAME: roxy.ns.cloudflare.com. RNAME: dns.cloudflare.com. Serial: 2034770004 Refresh: 10000 Retry: 2400 Expire: 604800 Minimum TTL: 3600

HTTP Headers

HTTP/1.1 403 Forbidden
Date: Tue, 23 Feb 2021 02:22:41 GMT
Server: Apache
Set-Cookie: 99e5ad143e170409c686b86fb82177cf=320924f730053fe50f16d77b4f2e4057; path=/; HttpOnly
Upgrade: h2,h2c
Connection: Upgrade
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8

Utilitiestrainingcentre.co.uk Whois Information

    Domain name:
        utilitiestrainingcentre.co.uk

    Data validation:
        Nominet was able to match the registrant's name and address against a 3rd party data source on 18-Oct-2018

    Registrar:
        VTSHosting Ltd [Tag = VTSHOSTING]
        URL: https://www.vtshosting.co.uk

    Relevant dates:
        Registered on: 13-Sep-2016
        Expiry date:  13-Sep-2021
        Last updated:  11-Sep-2020

    Registration status:
        Registered until expiry date.

    Name servers:
        roxy.ns.cloudflare.com
        tom.ns.cloudflare.com

    WHOIS lookup made at 02:22:43 23-Feb-2021

-- 
This

Utilitiestrainingcentre.co.uk valuation and analysis